Anti-VGLL4
Catalog Number:
ATA-HPA038225
- Images (8)
| Article Name: | Anti-VGLL4 |
| Biozol Catalog Number: | ATA-HPA038225 |
| Supplier Catalog Number: | HPA038225 |
| Alternative Catalog Number: | ATA-HPA038225-100,ATA-HPA038225-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA0121 |
| vestigial-like family member 4 |
| Anti-VGLL4 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 9686 |
| UniProt: | None |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PISPSKRKFSMEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | VGLL4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center. |
|
|
Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in myocytes as expected. |
|
|
Immunohistochemical staining of human endometrium shows moderate to strong positivity in glandular cells. |
|
|
Immunohistochemical staining of human cervix, uterine shows moderate nuclear positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate positivity in glandular cells. |
|
|
Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-VGLL4 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and VGLL4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415121). |
|
|
HPA038225-100ul |
Product Guarantee and Expert Support
