Anti-PARM1
Artikelnummer:
ATA-HPA038236
- Bilder (8)
| Artikelname: | Anti-PARM1 |
| Artikelnummer: | ATA-HPA038236 |
| Hersteller Artikelnummer: | HPA038236 |
| Alternativnummer: | ATA-HPA038236-100,ATA-HPA038236-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Cipar1, DKFZP564O0823, WSC4 |
| prostate androgen-regulated mucin-like protein 1 |
| Anti-PARM1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 25849 |
| UniProt: | Q6UWI2 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VPPTTIWTSSPQNTDADTASPSNGTHNNSVLPVTASAPTSLLPKNISIESREEEITSPGSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PARM1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, cytosol & vesicles. |
|
|
Immunohistochemical staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human placenta shows moderate to strong membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human kidney shows weak to moderate positivity in luminal membrane in cells in tubules. |
|
|
|
|
|
HPA038236-100ul |
|
|
HPA038236-100ul |
|
|
HPA038236-100ul |
Produktgarantie und fachkundiger Support
