Anti-PARM1
Catalog Number:
ATA-HPA038236
- Images (8)
| Article Name: | Anti-PARM1 |
| Biozol Catalog Number: | ATA-HPA038236 |
| Supplier Catalog Number: | HPA038236 |
| Alternative Catalog Number: | ATA-HPA038236-100,ATA-HPA038236-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Cipar1, DKFZP564O0823, WSC4 |
| prostate androgen-regulated mucin-like protein 1 |
| Anti-PARM1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 25849 |
| UniProt: | Q6UWI2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VPPTTIWTSSPQNTDADTASPSNGTHNNSVLPVTASAPTSLLPKNISIESREEEITSPGSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PARM1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, cytosol & vesicles. |
|
|
Immunohistochemical staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human placenta shows moderate to strong membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human kidney shows weak to moderate positivity in luminal membrane in cells in tubules. |
|
|
|
|
|
HPA038236-100ul |
|
|
HPA038236-100ul |
|
|
HPA038236-100ul |
Product Guarantee and Expert Support
