Anti-ST7, Rabbit, Polyclonal

Artikelnummer: ATA-HPA038325
Artikelname: Anti-ST7, Rabbit, Polyclonal
Artikelnummer: ATA-HPA038325
Hersteller Artikelnummer: HPA038325
Alternativnummer: ATA-HPA038325-100,ATA-HPA038325-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ETS7q, FAM4A, FAM4A1, HELG, RAY1, SEN4, TSG7
suppression of tumorigenicity 7
Anti-ST7
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 7982
UniProt: Q9NRC1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCATAY
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human pancreas shows moderate membranous positivity.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp