Anti-ST7, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ST7, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA038325
• Supplier Catalog Number: HPA038325
• Alternative Catalog Number: ATA-HPA038325-100,ATA-HPA038325-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, ICC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: ETS7q, FAM4A, FAM4A1, HELG, RAY1, SEN4, TSG7

Product Description

suppression of tumorigenicity 7

Additional Information

Anti-ST7

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 7982
• UniProt: Q9NRC1
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: PQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCATAY
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemical staining of human pancreas shows moderate membranous positivity.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp