Anti-ARHGAP32

Artikelnummer: ATA-HPA038389
Artikelname: Anti-ARHGAP32
Artikelnummer: ATA-HPA038389
Hersteller Artikelnummer: HPA038389
Alternativnummer: ATA-HPA038389-100,ATA-HPA038389-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GC-GAP, GRIT, KIAA0712, MGC1892, RICS
Rho GTPase activating protein 32
Anti-ARHGAP32
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 9743
UniProt: A7KAX9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ERDPSVLYQYQPHGKRQSSVTVVSQYDNLEDYHSLPQHQRGVFGGGGMGTYVPPGFPHPQSRTYATALGQGAFLPAELSLQHPETQIHAE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ARHGAP32
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line HaCaT shows localization to nucleoplasm, nucleoli fibrillar center & the Golgi apparatus.
Immunohistochemical staining of human small intestine shows moderate to strong positivity in luminal membrane in glandular cells.
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in glial cells.
Immunohistochemical staining of human skin shows weak to moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemical staining of human cerebellum shows moderate positivity in Purkinje cells.
HPA038389-100ul
HPA038389-100ul
HPA038389-100ul