Anti-ARHGAP32
Catalog Number:
ATA-HPA038389
- Images (9)
| Article Name: | Anti-ARHGAP32 |
| Biozol Catalog Number: | ATA-HPA038389 |
| Supplier Catalog Number: | HPA038389 |
| Alternative Catalog Number: | ATA-HPA038389-100,ATA-HPA038389-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | GC-GAP, GRIT, KIAA0712, MGC1892, RICS |
| Rho GTPase activating protein 32 |
| Anti-ARHGAP32 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 9743 |
| UniProt: | A7KAX9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ERDPSVLYQYQPHGKRQSSVTVVSQYDNLEDYHSLPQHQRGVFGGGGMGTYVPPGFPHPQSRTYATALGQGAFLPAELSLQHPETQIHAE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ARHGAP32 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line HaCaT shows localization to nucleoplasm, nucleoli fibrillar center & the Golgi apparatus. |
|
|
Immunohistochemical staining of human small intestine shows moderate to strong positivity in luminal membrane in glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in glial cells. |
|
|
Immunohistochemical staining of human skin shows weak to moderate cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human cerebellum shows moderate positivity in Purkinje cells. |
|
|
HPA038389-100ul |
|
|
|
|
|
HPA038389-100ul |
|
|
HPA038389-100ul |
Product Guarantee and Expert Support
