Anti-HAL
Artikelnummer:
ATA-HPA038547
- Bilder (8)
| Artikelname: | Anti-HAL |
| Artikelnummer: | ATA-HPA038547 |
| Hersteller Artikelnummer: | HPA038547 |
| Alternativnummer: | ATA-HPA038547-100,ATA-HPA038547-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HIS |
| histidine ammonia-lyase |
| Anti-HAL |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3034 |
| UniProt: | P42357 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FVEVVIEGDAMSPDFIPSQPEGVYLYSKYREPEKYIELDGDRLTTEDLVNLGKGRYKIKLTPTAEKRVQKSREVIDSIIKEKTVVYGITTGFGKFARTV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HAL |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human cerebral cortex, liver, skin and testis using Anti-HAL antibody HPA038547 (A) shows similar protein distribution across tissues to independent antibody HPA038548 (B). |
|
|
Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity. |
|
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells. |
|
|
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes. |
|
|
HPA038547-100ul |
|
|
HPA038547-100ul |
|
|
HPA038547-100ul |
Produktgarantie und fachkundiger Support
