Anti-HAL
Catalog Number:
ATA-HPA038547
- Images (8)
| Article Name: | Anti-HAL |
| Biozol Catalog Number: | ATA-HPA038547 |
| Supplier Catalog Number: | HPA038547 |
| Alternative Catalog Number: | ATA-HPA038547-100,ATA-HPA038547-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HIS |
| histidine ammonia-lyase |
| Anti-HAL |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 3034 |
| UniProt: | P42357 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FVEVVIEGDAMSPDFIPSQPEGVYLYSKYREPEKYIELDGDRLTTEDLVNLGKGRYKIKLTPTAEKRVQKSREVIDSIIKEKTVVYGITTGFGKFARTV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HAL |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human cerebral cortex, liver, skin and testis using Anti-HAL antibody HPA038547 (A) shows similar protein distribution across tissues to independent antibody HPA038548 (B). |
|
|
Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity. |
|
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells. |
|
|
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes. |
|
|
HPA038547-100ul |
|
|
HPA038547-100ul |
|
|
HPA038547-100ul |
Product Guarantee and Expert Support
