Anti-DNAH10
Artikelnummer:
ATA-HPA039066
- Bilder (9)
| Artikelname: | Anti-DNAH10 |
| Artikelnummer: | ATA-HPA039066 |
| Hersteller Artikelnummer: | HPA039066 |
| Alternativnummer: | ATA-HPA039066-100,ATA-HPA039066-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Molekularbiologie |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ43808 |
| dynein, axonemal, heavy chain 10 |
| Anti-DNAH10 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 196385 |
| UniProt: | Q8IVF4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SRLTLIEAINLFKYPAAKSEEELPGVKEFFEHIERERASDVDHMVRWYLAIGPLLTKVEGLVVHTNTGKAPKLASYYKYWEKKIYEVLTKLILKNLQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DNAH10 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemistry analysis in human testis and prostate tissues using HPA039066 antibody. Corresponding DNAH10 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows weak to moderate positivity in cilia in spermatids. |
|
|
Immunohistochemical staining of human fallopian tube shows weak to moderate positivity in cilia in glandular cells. |
|
|
Immunohistochemical staining of human bronchus shows weak to moderate positivity in cilia in respiratory epithelial cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected. |
|
|
Immunohistochemical staining of human prostate shows no positivity in glandular cells. |
|
|
HPA039066-100ul |
|
|
HPA039066-100ul |
|
|
HPA039066-100ul |
Produktgarantie und fachkundiger Support
