Anti-DNAH10
Catalog Number:
ATA-HPA039066
- Images (9)
| Article Name: | Anti-DNAH10 |
| Biozol Catalog Number: | ATA-HPA039066 |
| Supplier Catalog Number: | HPA039066 |
| Alternative Catalog Number: | ATA-HPA039066-100,ATA-HPA039066-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Molekularbiologie |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ43808 |
| dynein, axonemal, heavy chain 10 |
| Anti-DNAH10 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 196385 |
| UniProt: | Q8IVF4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SRLTLIEAINLFKYPAAKSEEELPGVKEFFEHIERERASDVDHMVRWYLAIGPLLTKVEGLVVHTNTGKAPKLASYYKYWEKKIYEVLTKLILKNLQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DNAH10 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemistry analysis in human testis and prostate tissues using HPA039066 antibody. Corresponding DNAH10 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows weak to moderate positivity in cilia in spermatids. |
|
|
Immunohistochemical staining of human fallopian tube shows weak to moderate positivity in cilia in glandular cells. |
|
|
Immunohistochemical staining of human bronchus shows weak to moderate positivity in cilia in respiratory epithelial cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected. |
|
|
Immunohistochemical staining of human prostate shows no positivity in glandular cells. |
|
|
HPA039066-100ul |
|
|
HPA039066-100ul |
|
|
HPA039066-100ul |
Product Guarantee and Expert Support
