Anti-CACNA1H
Artikelnummer:
ATA-HPA039125
- Bilder (9)
| Artikelname: | Anti-CACNA1H |
| Artikelnummer: | ATA-HPA039125 |
| Hersteller Artikelnummer: | HPA039125 |
| Alternativnummer: | ATA-HPA039125-100,ATA-HPA039125-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Cav3.2 |
| calcium channel, voltage-dependent, T type, alpha 1H subunit |
| Anti-CACNA1H |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8912 |
| UniProt: | O95180 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EEVSHITSSACPWQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRADEQWRPSAELGSGEPGEAKAWGPEAEPALGARRKKKMSP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CACNA1H |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & vesicles. |
|
|
Immunohistochemical staining of human hippocampus shows moderate membranous positivity in CA1 neurons. |
|
|
Immunohistochemical staining of human prostate shows moderate to strong membranous and cytoplasmic positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human urothelium shows moderate to strong membranous positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human tonsil shows only very weak positivity in lymphoid cells. |
|
|
HPA039125-100ul |
|
|
|
|
|
HPA039125-100ul |
|
|
HPA039125-100ul |
Produktgarantie und fachkundiger Support
