Anti-CACNA1H
Catalog Number:
ATA-HPA039125
- Images (9)
| Article Name: | Anti-CACNA1H |
| Biozol Catalog Number: | ATA-HPA039125 |
| Supplier Catalog Number: | HPA039125 |
| Alternative Catalog Number: | ATA-HPA039125-100,ATA-HPA039125-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Cav3.2 |
| calcium channel, voltage-dependent, T type, alpha 1H subunit |
| Anti-CACNA1H |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 8912 |
| UniProt: | O95180 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EEVSHITSSACPWQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRADEQWRPSAELGSGEPGEAKAWGPEAEPALGARRKKKMSP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CACNA1H |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & vesicles. |
|
|
Immunohistochemical staining of human hippocampus shows moderate membranous positivity in CA1 neurons. |
|
|
Immunohistochemical staining of human prostate shows moderate to strong membranous and cytoplasmic positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human urothelium shows moderate to strong membranous positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human tonsil shows only very weak positivity in lymphoid cells. |
|
|
HPA039125-100ul |
|
|
|
|
|
HPA039125-100ul |
|
|
HPA039125-100ul |
Product Guarantee and Expert Support
