Anti-UBE3A
Artikelnummer:
ATA-HPA039410
- Bilder (9)
| Artikelname: | Anti-UBE3A |
| Artikelnummer: | ATA-HPA039410 |
| Hersteller Artikelnummer: | HPA039410 |
| Alternativnummer: | ATA-HPA039410-100,ATA-HPA039410-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ANCR, AS, E6-AP, EPVE6AP, FLJ26981, HPVE6A |
| ubiquitin protein ligase E3A |
| Anti-UBE3A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 7337 |
| UniProt: | Q05086 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | HLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | UBE3A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human cerebellum shows strong nuclear positivity in Purkinje cells and cells in molecular layer. |
|
|
Western blot analysis using Anti-UBE3A antibody HPA039410 (A) shows similar pattern to independent antibody HPA040380 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
|
|
|
HPA039410-100ul |
|
|
|
|
|
HPA039410-100ul |
|
|
HPA039410-100ul |
Produktgarantie und fachkundiger Support
