Anti-UBE3A
Catalog Number:
ATA-HPA039410
- Images (9)
| Article Name: | Anti-UBE3A |
| Biozol Catalog Number: | ATA-HPA039410 |
| Supplier Catalog Number: | HPA039410 |
| Alternative Catalog Number: | ATA-HPA039410-100,ATA-HPA039410-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ANCR, AS, E6-AP, EPVE6AP, FLJ26981, HPVE6A |
| ubiquitin protein ligase E3A |
| Anti-UBE3A |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 7337 |
| UniProt: | Q05086 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | UBE3A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human cerebellum shows strong nuclear positivity in Purkinje cells and cells in molecular layer. |
|
|
Western blot analysis using Anti-UBE3A antibody HPA039410 (A) shows similar pattern to independent antibody HPA040380 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
|
|
|
HPA039410-100ul |
|
|
|
|
|
HPA039410-100ul |
|
|
HPA039410-100ul |
Product Guarantee and Expert Support
