Anti-TAZ
Artikelnummer:
ATA-HPA039557
- Bilder (8)
| Artikelname: | Anti-TAZ |
| Artikelnummer: | ATA-HPA039557 |
| Hersteller Artikelnummer: | HPA039557 |
| Alternativnummer: | ATA-HPA039557-100,ATA-HPA039557-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BTHS, CMD3A, EFE, EFE2, G4.5, XAP-2 |
| tafazzin |
| Anti-TAZ |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6901 |
| UniProt: | Q16635 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | WHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TAZ |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human spleen and liver tissues using HPA039557 antibody. Corresponding TAZ RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human spleen shows moderate membranous positivity in cells in red pulp. |
|
|
Immunohistochemical staining of human liver shows very weak membranous positivity in hepatocytes. |
|
|
HPA039557-100ul |
|
|
HPA039557-100ul |
|
|
HPA039557-100ul |
Produktgarantie und fachkundiger Support
