Anti-TAZ
Catalog Number:
ATA-HPA039557
- Images (8)
| Article Name: | Anti-TAZ |
| Biozol Catalog Number: | ATA-HPA039557 |
| Supplier Catalog Number: | HPA039557 |
| Alternative Catalog Number: | ATA-HPA039557-100,ATA-HPA039557-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BTHS, CMD3A, EFE, EFE2, G4.5, XAP-2 |
| tafazzin |
| Anti-TAZ |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 6901 |
| UniProt: | Q16635 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | WHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TAZ |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human spleen and liver tissues using HPA039557 antibody. Corresponding TAZ RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human spleen shows moderate membranous positivity in cells in red pulp. |
|
|
Immunohistochemical staining of human liver shows very weak membranous positivity in hepatocytes. |
|
|
HPA039557-100ul |
|
|
HPA039557-100ul |
|
|
HPA039557-100ul |
Product Guarantee and Expert Support
