Anti-HADH
Artikelnummer:
ATA-HPA039588
- Bilder (7)
| Artikelname: | Anti-HADH |
| Artikelnummer: | ATA-HPA039588 |
| Hersteller Artikelnummer: | HPA039588 |
| Alternativnummer: | ATA-HPA039588-100,ATA-HPA039588-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HADH1, HADHSC, SCHAD |
| hydroxyacyl-CoA dehydrogenase |
| Anti-HADH |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3033 |
| UniProt: | Q16836 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | YLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFY |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HADH |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes. |
|
|
Western blot analysis using Anti-HADH antibody HPA039588 (A) shows similar pattern to independent antibody HPA043888 (B). |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA039588-100ul |
|
|
|
|
|
HPA039588-100ul |
|
|
HPA039588-100ul |
Produktgarantie und fachkundiger Support
