Anti-HADH
Catalog Number:
ATA-HPA039588
- Images (7)
| Article Name: | Anti-HADH |
| Biozol Catalog Number: | ATA-HPA039588 |
| Supplier Catalog Number: | HPA039588 |
| Alternative Catalog Number: | ATA-HPA039588-100,ATA-HPA039588-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HADH1, HADHSC, SCHAD |
| hydroxyacyl-CoA dehydrogenase |
| Anti-HADH |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Isotype: | IgG |
| NCBI: | 3033 |
| UniProt: | Q16836 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFY |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HADH |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes. |
|
|
Western blot analysis using Anti-HADH antibody HPA039588 (A) shows similar pattern to independent antibody HPA043888 (B). |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA039588-100ul |
|
|
|
|
|
HPA039588-100ul |
|
|
HPA039588-100ul |
Product Guarantee and Expert Support
