Anti-GIF
Artikelnummer:
ATA-HPA039908
- Bilder (8)
| Artikelname: | Anti-GIF |
| Artikelnummer: | ATA-HPA039908 |
| Hersteller Artikelnummer: | HPA039908 |
| Alternativnummer: | ATA-HPA039908-100,ATA-HPA039908-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IF, IFMH, INF, TCN3 |
| gastric intrinsic factor (vitamin B synthesis) |
| Anti-GIF |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2694 |
| UniProt: | P27352 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GIF |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human stomach and liver tissues using Anti-GIF antibody. Corresponding GIF RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human stomach shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and GIF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY417460). |
|
|
HPA039908-100ul |
|
|
|
|
|
HPA039908-100ul |
|
|
HPA039908-100ul |
Produktgarantie und fachkundiger Support
