Anti-GIF

Catalog Number: ATA-HPA039908
Article Name: Anti-GIF
Biozol Catalog Number: ATA-HPA039908
Supplier Catalog Number: HPA039908
Alternative Catalog Number: ATA-HPA039908-100,ATA-HPA039908-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: IF, IFMH, INF, TCN3
gastric intrinsic factor (vitamin B synthesis)
Anti-GIF
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 2694
UniProt: P27352
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GIF
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human stomach and liver tissues using Anti-GIF antibody. Corresponding GIF RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human stomach shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and GIF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY417460).
HPA039908-100ul
HPA039908-100ul
HPA039908-100ul