Anti-DNAJC22

Artikelnummer: ATA-HPA039953
Artikelname: Anti-DNAJC22
Artikelnummer: ATA-HPA039953
Hersteller Artikelnummer: HPA039953
Alternativnummer: ATA-HPA039953-100,ATA-HPA039953-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Molekularbiologie
Applikation: ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ13236, wus
DnaJ (Hsp40) homolog, subfamily C, member 22
Anti-DNAJC22
Klonalität: Polyclonal
Konzentration: 0.8 mg/ml
Isotyp: IgG
NCBI: 79962
UniProt: Q8N4W6
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DNAJC22
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Western blot analysis in human cell line RT-4.
HPA039953-100ul
HPA039953-100ul