Anti-DNAJC22
Catalog Number:
ATA-HPA039953
- Images (4)
| Article Name: | Anti-DNAJC22 |
| Biozol Catalog Number: | ATA-HPA039953 |
| Supplier Catalog Number: | HPA039953 |
| Alternative Catalog Number: | ATA-HPA039953-100,ATA-HPA039953-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Molekularbiologie |
| Application: | ICC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ13236, wus |
| DnaJ (Hsp40) homolog, subfamily C, member 22 |
| Anti-DNAJC22 |
| Clonality: | Polyclonal |
| Concentration: | 0.8 mg/ml |
| Isotype: | IgG |
| NCBI: | 79962 |
| UniProt: | Q8N4W6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DNAJC22 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles. |
|
|
Western blot analysis in human cell line RT-4. |
|
|
HPA039953-100ul |
|
|
HPA039953-100ul |
Product Guarantee and Expert Support
