Anti-INTS14
Artikelnummer:
ATA-HPA040255
- Bilder (7)
| Artikelname: | Anti-INTS14 |
| Artikelnummer: | ATA-HPA040255 |
| Hersteller Artikelnummer: | HPA040255 |
| Alternativnummer: | ATA-HPA040255-100,ATA-HPA040255-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C15orf44, DKFZP564O1664, VWA9 |
| integrator complex subunit 14 |
| Anti-INTS14 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 81556 |
| UniProt: | Q96SY0 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LTADVQVFPRPEPFVVDEEIDPIPKVINTDLEIVGFIDIADISSPPVLSRHLVLPIALNKEGDEVGTGITDDNEDENSANQIAGKIPNFCVLLHGSLKVEGMVAIVQL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | INTS14 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & mitochondria. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts and leydig cells. |
|
|
Western blot analysis using Anti-INTS14 antibody HPA040255 (A) shows similar pattern to independent antibody HPA040651 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA040255-100ul |
|
|
HPA040255-100ul |
|
|
HPA040255-100ul |
Produktgarantie und fachkundiger Support
