Anti-INTS14
Catalog Number:
ATA-HPA040255
- Images (7)
| Article Name: | Anti-INTS14 |
| Biozol Catalog Number: | ATA-HPA040255 |
| Supplier Catalog Number: | HPA040255 |
| Alternative Catalog Number: | ATA-HPA040255-100,ATA-HPA040255-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C15orf44, DKFZP564O1664, VWA9 |
| integrator complex subunit 14 |
| Anti-INTS14 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 81556 |
| UniProt: | Q96SY0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LTADVQVFPRPEPFVVDEEIDPIPKVINTDLEIVGFIDIADISSPPVLSRHLVLPIALNKEGDEVGTGITDDNEDENSANQIAGKIPNFCVLLHGSLKVEGMVAIVQL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | INTS14 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & mitochondria. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts and leydig cells. |
|
|
Western blot analysis using Anti-INTS14 antibody HPA040255 (A) shows similar pattern to independent antibody HPA040651 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA040255-100ul |
|
|
HPA040255-100ul |
|
|
HPA040255-100ul |
Product Guarantee and Expert Support
