Anti-PLBD1
Artikelnummer:
ATA-HPA040303
- Bilder (8)
| Artikelname: | Anti-PLBD1 |
| Artikelnummer: | ATA-HPA040303 |
| Hersteller Artikelnummer: | HPA040303 |
| Alternativnummer: | ATA-HPA040303-100,ATA-HPA040303-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ22662 |
| phospholipase B domain containing 1 |
| Anti-PLBD1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 79887 |
| UniProt: | Q6P4A8 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | WMPAEKTVQVKNVMDKNGDAYGFYNNSVKTTGWGILEIRAGYGSQTLSNEIIMFVAGFLEGYLTAPHMNDHYTNLYPQLITKPSIMDKVQDFMEKQD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PLBD1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human lung and cerebral cortex tissues using HPA040303 antibody. Corresponding PLBD1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity as expected. |
|
|
HPA040303-100ul |
|
|
HPA040303-100ul |
|
|
HPA040303-100ul |
Produktgarantie und fachkundiger Support
