Anti-PLBD1
Catalog Number:
ATA-HPA040303
- Images (8)
| Article Name: | Anti-PLBD1 |
| Biozol Catalog Number: | ATA-HPA040303 |
| Supplier Catalog Number: | HPA040303 |
| Alternative Catalog Number: | ATA-HPA040303-100,ATA-HPA040303-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ22662 |
| phospholipase B domain containing 1 |
| Anti-PLBD1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 79887 |
| UniProt: | Q6P4A8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | WMPAEKTVQVKNVMDKNGDAYGFYNNSVKTTGWGILEIRAGYGSQTLSNEIIMFVAGFLEGYLTAPHMNDHYTNLYPQLITKPSIMDKVQDFMEKQD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PLBD1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human lung and cerebral cortex tissues using HPA040303 antibody. Corresponding PLBD1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity as expected. |
|
|
HPA040303-100ul |
|
|
HPA040303-100ul |
|
|
HPA040303-100ul |
Product Guarantee and Expert Support
