Anti-SPEF2
Artikelnummer:
ATA-HPA040343
- Bilder (9)
| Artikelname: | Anti-SPEF2 |
| Artikelnummer: | ATA-HPA040343 |
| Hersteller Artikelnummer: | HPA040343 |
| Alternativnummer: | ATA-HPA040343-100,ATA-HPA040343-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CT122, FLJ23577, KPL2 |
| sperm flagellar 2 |
| Anti-SPEF2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 79925 |
| UniProt: | Q9C093 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LGTITFEQYMQAGLWFTGDEDIKIPENPLEPLPFNRQEHLIEFFFRLFADYEKDPPQLDYTQMLLYFACHPDTVEGVYRALSVAVGTHVFQQVKA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SPEF2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemistry analysis in human fallopian tube and liver tissues using Anti-SPEF2 antibody. Corresponding SPEF2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, fallopian tube, liver and lymph node using Anti-SPEF2 antibody HPA040343 (A) shows similar protein distribution across tissues to independent antibody HPA039606 (B). |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human lymph node using Anti-SPEF2 antibody HPA040343. |
|
|
Immunohistochemical staining of human colon using Anti-SPEF2 antibody HPA040343. |
|
|
HPA040343-100ul |
|
|
HPA040343-100ul |
|
|
HPA040343-100ul |
Produktgarantie und fachkundiger Support
