Anti-SPEF2
Catalog Number:
ATA-HPA040343
- Images (9)
| Article Name: | Anti-SPEF2 |
| Biozol Catalog Number: | ATA-HPA040343 |
| Supplier Catalog Number: | HPA040343 |
| Alternative Catalog Number: | ATA-HPA040343-100,ATA-HPA040343-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CT122, FLJ23577, KPL2 |
| sperm flagellar 2 |
| Anti-SPEF2 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 79925 |
| UniProt: | Q9C093 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LGTITFEQYMQAGLWFTGDEDIKIPENPLEPLPFNRQEHLIEFFFRLFADYEKDPPQLDYTQMLLYFACHPDTVEGVYRALSVAVGTHVFQQVKA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SPEF2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemistry analysis in human fallopian tube and liver tissues using Anti-SPEF2 antibody. Corresponding SPEF2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, fallopian tube, liver and lymph node using Anti-SPEF2 antibody HPA040343 (A) shows similar protein distribution across tissues to independent antibody HPA039606 (B). |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human lymph node using Anti-SPEF2 antibody HPA040343. |
|
|
Immunohistochemical staining of human colon using Anti-SPEF2 antibody HPA040343. |
|
|
HPA040343-100ul |
|
|
HPA040343-100ul |
|
|
HPA040343-100ul |
Product Guarantee and Expert Support
