Anti-CRYL1
Artikelnummer:
ATA-HPA040403
- Bilder (8)
| Artikelname: | Anti-CRYL1 |
| Artikelnummer: | ATA-HPA040403 |
| Hersteller Artikelnummer: | HPA040403 |
| Alternativnummer: | ATA-HPA040403-100,ATA-HPA040403-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GDH, lambda-CRY, MGC149525, MGC149526 |
| crystallin, lambda 1 |
| Anti-CRYL1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 51084 |
| UniProt: | Q9Y2S2 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | IRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLM |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CRYL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleus, nucleoli & the Golgi apparatus. |
|
|
Immunohistochemistry analysis in human kidney and skeletal muscle tissues using Anti-CRYL1 antibody. Corresponding CRYL1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
HPA040403-100ul |
|
|
|
|
|
HPA040403-100ul |
|
|
HPA040403-100ul |
Produktgarantie und fachkundiger Support
