Anti-CRYL1

Catalog Number: ATA-HPA040403
Article Name: Anti-CRYL1
Biozol Catalog Number: ATA-HPA040403
Supplier Catalog Number: HPA040403
Alternative Catalog Number: ATA-HPA040403-100,ATA-HPA040403-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GDH, lambda-CRY, MGC149525, MGC149526
crystallin, lambda 1
Anti-CRYL1
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 51084
UniProt: Q9Y2S2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLM
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CRYL1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500
Immunofluorescent staining of human cell line A-431 shows localization to nucleus, nucleoli & the Golgi apparatus.
Immunohistochemistry analysis in human kidney and skeletal muscle tissues using Anti-CRYL1 antibody. Corresponding CRYL1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
HPA040403-100ul
HPA040403-100ul
HPA040403-100ul