Anti-ATP2B4

Artikelnummer: ATA-HPA040431
Artikelname: Anti-ATP2B4
Artikelnummer: ATA-HPA040431
Hersteller Artikelnummer: HPA040431
Alternativnummer: ATA-HPA040431-100,ATA-HPA040431-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ATP2B2, MXRA1, PMCA4
ATPase, Ca++ transporting, plasma membrane 4
Anti-ATP2B4
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 493
UniProt: P23634
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: THPEFAIEEELPRTPLLDEEEEENPDKASKFGTRVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQSLETSV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ATP2B4
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.
Immunohistochemistry analysis in human fallopian tube and pancreas tissues using Anti-ATP2B4 antibody. Corresponding ATP2B4 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA040431-100ul
HPA040431-100ul
HPA040431-100ul