Anti-ATP2B4

Catalog Number: ATA-HPA040431
Article Name: Anti-ATP2B4
Biozol Catalog Number: ATA-HPA040431
Supplier Catalog Number: HPA040431
Alternative Catalog Number: ATA-HPA040431-100,ATA-HPA040431-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ATP2B2, MXRA1, PMCA4
ATPase, Ca++ transporting, plasma membrane 4
Anti-ATP2B4
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 493
UniProt: P23634
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: THPEFAIEEELPRTPLLDEEEEENPDKASKFGTRVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQSLETSV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ATP2B4
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.
Immunohistochemistry analysis in human fallopian tube and pancreas tissues using Anti-ATP2B4 antibody. Corresponding ATP2B4 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA040431-100ul
HPA040431-100ul
HPA040431-100ul