Anti-PLAC8
Artikelnummer:
ATA-HPA040465
- Bilder (9)
| Artikelname: | Anti-PLAC8 |
| Artikelnummer: | ATA-HPA040465 |
| Hersteller Artikelnummer: | HPA040465 |
| Alternativnummer: | ATA-HPA040465-100,ATA-HPA040465-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C15, onzin |
| placenta-specific 8 |
| Anti-PLAC8 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 51316 |
| UniProt: | Q9NZF1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PLAC8 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human lymphoid tissues shows moderate to strong cytoplasmic positivity in non-germinal center cells. |
|
|
Immunohistochemical staining of human gastrointestinal tract shows moderate to strong cytoplasmic positivity in cells in lamina propria. |
|
|
Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in peripheral blood leukocytes. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Western blot analysis in human spleen tissue. |
|
|
HPA040465-100ul |
|
|
|
|
|
HPA040465-100ul |
|
|
HPA040465-100ul |
Produktgarantie und fachkundiger Support
