Anti-PLAC8
Catalog Number:
ATA-HPA040465
- Images (9)
| Article Name: | Anti-PLAC8 |
| Biozol Catalog Number: | ATA-HPA040465 |
| Supplier Catalog Number: | HPA040465 |
| Alternative Catalog Number: | ATA-HPA040465-100,ATA-HPA040465-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C15, onzin |
| placenta-specific 8 |
| Anti-PLAC8 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 51316 |
| UniProt: | Q9NZF1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PLAC8 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human lymphoid tissues shows moderate to strong cytoplasmic positivity in non-germinal center cells. |
|
|
Immunohistochemical staining of human gastrointestinal tract shows moderate to strong cytoplasmic positivity in cells in lamina propria. |
|
|
Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in peripheral blood leukocytes. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Western blot analysis in human spleen tissue. |
|
|
HPA040465-100ul |
|
|
|
|
|
HPA040465-100ul |
|
|
HPA040465-100ul |
Product Guarantee and Expert Support
