Anti-MUC5AC

Artikelnummer: ATA-HPA040615
Artikelname: Anti-MUC5AC
Artikelnummer: ATA-HPA040615
Hersteller Artikelnummer: HPA040615
Alternativnummer: ATA-HPA040615-100,ATA-HPA040615-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MUC5
mucin 5AC, oligomeric mucus/gel-forming
Anti-MUC5AC
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 4586
UniProt: P98088
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSGGRWSCQEVPCPG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MUC5AC
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human stomach and kidney tissues using HPA040615 antibody. Corresponding MUC5AC RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human duodenum shows no positivity in glandular cells as expected.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemical staining of human kidney shows no positivity as expected.
Immunohistochemical staining of human stomach shows moderate positivity in mucus in glandular cells.
HPA040615-100ul
HPA040615-100ul
HPA040615-100ul