Anti-MUC5AC
Catalog Number:
ATA-HPA040615
- Images (8)
| Article Name: | Anti-MUC5AC |
| Biozol Catalog Number: | ATA-HPA040615 |
| Supplier Catalog Number: | HPA040615 |
| Alternative Catalog Number: | ATA-HPA040615-100,ATA-HPA040615-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MUC5 |
| mucin 5AC, oligomeric mucus/gel-forming |
| Anti-MUC5AC |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 4586 |
| UniProt: | P98088 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSGGRWSCQEVPCPG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MUC5AC |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human stomach and kidney tissues using HPA040615 antibody. Corresponding MUC5AC RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human duodenum shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human kidney shows no positivity as expected. |
|
|
Immunohistochemical staining of human stomach shows moderate positivity in mucus in glandular cells. |
|
|
HPA040615-100ul |
|
|
HPA040615-100ul |
|
|
HPA040615-100ul |
Product Guarantee and Expert Support
