Anti-SLC8B1
Artikelnummer:
ATA-HPA040668
- Bilder (7)
| Artikelname: | Anti-SLC8B1 |
| Artikelnummer: | ATA-HPA040668 |
| Hersteller Artikelnummer: | HPA040668 |
| Alternativnummer: | ATA-HPA040668-100,ATA-HPA040668-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ22233, NCKX6, NCLX, SLC24A6 |
| solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 |
| Anti-SLC8B1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 80024 |
| UniProt: | Q6J4K2 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKAL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC8B1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human pancreas shows strong positivity in mitochondria in exocrine glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Immunohistochemical staining of small intestine shows strong granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules. |
|
|
HPA040668-100ul |
|
|
HPA040668-100ul |
|
|
HPA040668-100ul |
Produktgarantie und fachkundiger Support
