Anti-SLC8B1
Catalog Number:
ATA-HPA040668
- Images (7)
| Article Name: | Anti-SLC8B1 |
| Biozol Catalog Number: | ATA-HPA040668 |
| Supplier Catalog Number: | HPA040668 |
| Alternative Catalog Number: | ATA-HPA040668-100,ATA-HPA040668-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ22233, NCKX6, NCLX, SLC24A6 |
| solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 |
| Anti-SLC8B1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 80024 |
| UniProt: | Q6J4K2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKAL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC8B1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human pancreas shows strong positivity in mitochondria in exocrine glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Immunohistochemical staining of small intestine shows strong granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules. |
|
|
HPA040668-100ul |
|
|
HPA040668-100ul |
|
|
HPA040668-100ul |
Product Guarantee and Expert Support
