Anti-MED20 ChIP certified

Artikelnummer: ATA-HPA040717
Artikelname: Anti-MED20 ChIP certified
Artikelnummer: ATA-HPA040717
Hersteller Artikelnummer: HPA040717
Alternativnummer: ATA-HPA040717-100,ATA-HPA040717-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DKFZp586D2223, PRO0213, TRFP
mediator complex subunit 20
Anti-MED20
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 9477
UniProt: Q9H944
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MED20
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & centrosome.
Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.
Immunohistochemical staining of human kidney shows moderate nuclear positivity in cells in tubules.
Immunohistochemical staining of human endometrium shows moderate nuclear positivity.
HPA040717-100ul
HPA040717-100ul
HPA040717-100ul