Anti-MED20 ChIP certified

Catalog Number: ATA-HPA040717
Article Name: Anti-MED20 ChIP certified
Biozol Catalog Number: ATA-HPA040717
Supplier Catalog Number: HPA040717
Alternative Catalog Number: ATA-HPA040717-100,ATA-HPA040717-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp586D2223, PRO0213, TRFP
mediator complex subunit 20
Anti-MED20
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 9477
UniProt: Q9H944
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MED20
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & centrosome.
Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.
Immunohistochemical staining of human kidney shows moderate nuclear positivity in cells in tubules.
Immunohistochemical staining of human endometrium shows moderate nuclear positivity.
HPA040717-100ul
HPA040717-100ul
HPA040717-100ul