Anti-PPP4R1
Artikelnummer:
ATA-HPA040905
- Bilder (7)
| Artikelname: | Anti-PPP4R1 |
| Artikelnummer: | ATA-HPA040905 |
| Hersteller Artikelnummer: | HPA040905 |
| Alternativnummer: | ATA-HPA040905-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PP4R1 |
| protein phosphatase 4, regulatory subunit 1 |
| Anti-PPP4R1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9989 |
| UniProt: | Q8TF05 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PLDSSLLCTLSSESHQEAASNENDKKPGNYKSMLRPEVGTTSQDSALLDQELYNSFHFWRTPLPEIDLDIELEQNSG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PPP4R1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PPP4R1 antibody. Remaining relative intensity is presented. |
|
|
Western blot analysis using Anti-PPP4R1 antibody HPA040905 (A) shows similar pattern to independent antibody HPA041089 (B). |
|
|
HPA040905-100ul |
|
|
HPA040905-100ul |
|
|
HPA040905-100ul |
Produktgarantie und fachkundiger Support
