Anti-PPP4R1
Catalog Number:
ATA-HPA040905
- Images (7)
| Article Name: | Anti-PPP4R1 |
| Biozol Catalog Number: | ATA-HPA040905 |
| Supplier Catalog Number: | HPA040905 |
| Alternative Catalog Number: | ATA-HPA040905-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PP4R1 |
| protein phosphatase 4, regulatory subunit 1 |
| Anti-PPP4R1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 9989 |
| UniProt: | Q8TF05 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PLDSSLLCTLSSESHQEAASNENDKKPGNYKSMLRPEVGTTSQDSALLDQELYNSFHFWRTPLPEIDLDIELEQNSG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PPP4R1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PPP4R1 antibody. Remaining relative intensity is presented. |
|
|
Western blot analysis using Anti-PPP4R1 antibody HPA040905 (A) shows similar pattern to independent antibody HPA041089 (B). |
|
|
HPA040905-100ul |
|
|
HPA040905-100ul |
|
|
HPA040905-100ul |
Product Guarantee and Expert Support
