Anti-DNAJC17

Artikelnummer: ATA-HPA040914
Artikelname: Anti-DNAJC17
Artikelnummer: ATA-HPA040914
Hersteller Artikelnummer: HPA040914
Alternativnummer: ATA-HPA040914-100,ATA-HPA040914-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ10634
DnaJ (Hsp40) homolog, subfamily C, member 17
Anti-DNAJC17
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 55192
UniProt: Q9NVM6
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: AVVEFATVKAAELAVQNEVGLVDNPLKISWLEGQPQDAVGRSHSGLSKGSVLSERDYESLVMMRMRQAAERQQLIARMQQEDQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DNAJC17
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemical staining of human stomach, upper shows moderate cytoplasmic and nuclear positivity in glandular cells.
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-DNAJC17 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Western blot analysis using Anti-DNAJC17 antibody HPA040914 (A) shows similar pattern to independent antibody HPA041187 (B).
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA040914-100ul
HPA040914-100ul
HPA040914-100ul