Anti-DNAJC17
Catalog Number:
ATA-HPA040914
- Images (8)
| Article Name: | Anti-DNAJC17 |
| Biozol Catalog Number: | ATA-HPA040914 |
| Supplier Catalog Number: | HPA040914 |
| Alternative Catalog Number: | ATA-HPA040914-100,ATA-HPA040914-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Molekularbiologie |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ10634 |
| DnaJ (Hsp40) homolog, subfamily C, member 17 |
| Anti-DNAJC17 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 55192 |
| UniProt: | Q9NVM6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | AVVEFATVKAAELAVQNEVGLVDNPLKISWLEGQPQDAVGRSHSGLSKGSVLSERDYESLVMMRMRQAAERQQLIARMQQEDQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DNAJC17 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human stomach, upper shows moderate cytoplasmic and nuclear positivity in glandular cells. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-DNAJC17 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Western blot analysis using Anti-DNAJC17 antibody HPA040914 (A) shows similar pattern to independent antibody HPA041187 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA040914-100ul |
|
|
HPA040914-100ul |
|
|
HPA040914-100ul |
Product Guarantee and Expert Support
