Anti-CPPED1
Artikelnummer:
ATA-HPA040938
- Bilder (7)
| Artikelname: | Anti-CPPED1 |
| Artikelnummer: | ATA-HPA040938 |
| Hersteller Artikelnummer: | HPA040938 |
| Alternativnummer: | ATA-HPA040938-100,ATA-HPA040938-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CSTP1, FLJ11151 |
| calcineurin-like phosphoesterase domain containing 1 |
| Anti-CPPED1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 55313 |
| UniProt: | Q9BRF8 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MSDAEAGGVFHRARGRTLAAFPAEKESEWKGPFYFILGADPQFGLIKAWSTGDCDNGGDEWEQEIRLTEQAVQAINKLNPKPKFFVLCGDLIHAMP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CPPED1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells of tubules. |
|
|
Western blot analysis in human cell lines A-549 and U-251MG using Anti-CPPED1 antibody. Corresponding CPPED1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 |
|
|
HPA040938-100ul |
|
|
|
|
|
HPA040938-100ul |
|
|
HPA040938-100ul |
Produktgarantie und fachkundiger Support
