Anti-CPPED1

Catalog Number: ATA-HPA040938
Article Name: Anti-CPPED1
Biozol Catalog Number: ATA-HPA040938
Supplier Catalog Number: HPA040938
Alternative Catalog Number: ATA-HPA040938-100,ATA-HPA040938-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CSTP1, FLJ11151
calcineurin-like phosphoesterase domain containing 1
Anti-CPPED1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 55313
UniProt: Q9BRF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MSDAEAGGVFHRARGRTLAAFPAEKESEWKGPFYFILGADPQFGLIKAWSTGDCDNGGDEWEQEIRLTEQAVQAINKLNPKPKFFVLCGDLIHAMP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CPPED1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
Western blot analysis in human cell lines A-549 and U-251MG using Anti-CPPED1 antibody. Corresponding CPPED1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
HPA040938-100ul
HPA040938-100ul
HPA040938-100ul