Anti-CD3E

Artikelnummer: ATA-HPA040957
Artikelname: Anti-CD3E
Artikelnummer: ATA-HPA040957
Hersteller Artikelnummer: HPA040957
Alternativnummer: ATA-HPA040957-100,ATA-HPA040957-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Pan-Cancer
CD3e molecule, epsilon (CD3-TCR complex)
Anti-CD3E
Klonalität: Polyclonal
Konzentration: 0.4 mg/ml
Isotyp: IgG
NCBI: 916
UniProt: P07766
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD3E
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human lymph node and small intestine tissues using HPA040957 antibody. Corresponding CD3E RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, lymph node, spleen and tonsil using Anti-CD3E antibody HPA040957 (A) shows similar protein distribution across tissues to independent antibody HPA043955 (B).
Immunohistochemical staining of human purkinje layer of the cerebellum shows no cytoplasmic positivity as expected.
Immunohistochemical staining of human spleen shows weak to moderate cytoplasmic positivity in cells in red pulp.
Immunohistochemical staining of human small intestine shows weak to moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemical staining of human lymph node shows weak to moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemical staining of human tonsil using Anti-CD3E antibody HPA040957.
Immunohistochemical staining of human cerebral cortex using Anti-CD3E antibody HPA040957.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Lane 4: Human plasma
Lane 5: Human Liver tissue
Lane 6: Human Tonsil tissue
HPA040957-100ul
HPA040957-100ul
HPA040957-100ul