Anti-CD3E Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA040957
- Images (13)
| Article Name: | Anti-CD3E Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA040957 |
| Supplier Catalog Number: | HPA040957 |
| Alternative Catalog Number: | ATA-HPA040957-100,ATA-HPA040957-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Pan-Cancer |
| CD3e molecule, epsilon (CD3-TCR complex) |
| Anti-CD3E |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 916 |
| UniProt: | P07766 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD3E |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human lymph node and small intestine tissues using HPA040957 antibody. Corresponding CD3E RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, lymph node, spleen and tonsil using Anti-CD3E antibody HPA040957 (A) shows similar protein distribution across tissues to independent antibody HPA043955 (B). |
|
|
Immunohistochemical staining of human purkinje layer of the cerebellum shows no cytoplasmic positivity as expected. |
|
|
Immunohistochemical staining of human spleen shows weak to moderate cytoplasmic positivity in cells in red pulp. |
|
|
Immunohistochemical staining of human small intestine shows weak to moderate cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human lymph node shows weak to moderate cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human tonsil using Anti-CD3E antibody HPA040957. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-CD3E antibody HPA040957. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue |
|
|
|
|
|
HPA040957 |
|
|
HPA040957 |
|
|
HPA040957 |
Product Guarantee and Expert Support
