Anti-RMI2
Artikelnummer:
ATA-HPA040995
- Bilder (8)
| Artikelname: | Anti-RMI2 |
| Artikelnummer: | ATA-HPA040995 |
| Hersteller Artikelnummer: | HPA040995 |
| Alternativnummer: | ATA-HPA040995-100,ATA-HPA040995-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BLAP18, C16orf75, MGC24665 |
| RecQ mediated genome instability 2 |
| Anti-RMI2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 116028 |
| UniProt: | Q96E14 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RMI2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles & cytosol. |
|
|
Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell lines MCF-7 and U-251MG using Anti-RMI2 antibody. Corresponding RMI2 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
HPA040995-100ul |
|
|
|
|
|
|
|
|
HPA040995-100ul |
|
|
HPA040995-100ul |
Produktgarantie und fachkundiger Support
